| Annotated protein: | Guanine deaminase (Guanase) (Guanine aminase) (EC 3.5.4.3) (Guanine aminohydrolase) (GAH). Gene symbol: GDA. Taxonomy: Rattus norvegicus (Rat). Uniprot ID: Q9WTT6 |
| antibody wiki: | |
| SynGO gene info: | SynGO data @ GDA |
| Ontology domain: | Cellular Component |
| SynGO term: | postsynapse (GO:0098794) |
| Annotated paper: | Kuwahara H, et al. "A novel NE-dlg/SAP102-associated protein, p51-nedasin, related to the amidohydrolase superfamily, interferes with the association between NE-dlg/SAP102 and N-methyl-D-aspartate receptor" J Biol Chem. 1999 Nov 5;274(45):32204-14 PMID:10542258 |
| Figure(s): | Figure 4-7 |
| Annotation description: | Figure 4,5: GDA (p51-nedasin) interacts with DLG3 (SAP102) in pulldown assays using fusion proteins expressed in COS-7 cells. Various sequence variants/mutants are used as controls, identifying the binding site for DLG3 (PDZ1 and/or PDZ2). Figure 6C: The same interaction was found in endogenous pulldowns from adult rat brain (crude cytosol). Figure 7: co-localization of both proteins was observed in (low resolution) confocal imaging of normal human neural progenitor cells at 21 days in culture. |
| Evidence tracking, Biological System: | Cultured neurons Non-neuronal tissue Intact tissue |
| Evidence tracking, Protein Targeting: | Antibody (detection) Over-expression |
| Evidence tracking, Experiment Assay: | IP + WB/MSMS Confocal |
| Annotator(s): | Frank Koopmans (ORCID:0000-0002-4973-5732) Guus Smit (ORCID:0000-0002-2286-1587) Matthijs Verhage (ORCID:0000-0002-2514-0216) |
| Lab: | Department of Functional Genomics, Department of Molecular and Cellular Neurobiology, Center for Neurogenomics and Cognitive Research, Vrije Universiteit Amsterdam, 1081 HV Amsterdam, The Netherlands |
| Additional literature: | around the same time as currently annotated paper, this reference characterized the same protein and also showed synaptic localization but gave the protein another name; Cypin (to confirm this is the same protein, we used BLAST and found 100% match between the sequence PGLVDTHIHAPQYAFAGSNVDLPLLDWLNKYT shown in this Figure 1 and the protein annotated here) @ PMID:10595517 |
| SynGO annotation ID: | 5548 |
| Dataset release (version): | 20231201 |
| View annotation as GO-CAM model: |