| Annotated protein: | FXYD domain-containing ion transport regulator 6 (PLM-like protein) (Phosphohippolin). Gene symbol: FXYD6. Taxonomy: Mus musculus (Mouse). Uniprot ID: Q9D164 |
| antibody wiki: | |
| SynGO gene info: | SynGO data @ FXYD6 |
| Ontology domain: | Cellular Component |
| SynGO term: | integral component of postsynaptic membrane (GO:0099055) |
| Synapse type(s): | hippocampus, glutamatergic striatum, glutamatergic |
| Annotated paper: | Biesemann C, et al. "Proteomic screening of glutamatergic mouse brain synaptosomes isolated by fluorescence activated sorting" EMBO J. 2014 Jan 13;33(2):157-70 PMID:24413018 |
| Figure(s): | Fig.6A-E, Fig.S3 |
| Annotation description: | FXYD6 is localized to presynaptic and postsynaptic membranes. FXYD6 is a poorly characterized member of the FXYD protein family with one transmembrane domain (See reference). In the present study it has been found to be specifically enriched in FASS-sorted, VGluT1Venus-containing synaptosomes. Subcellular fractionation revealed FXYD6 to be strongly enriched in the synaptic plasma membrane fraction (LP1B, Fig.6 B). Immunocytochemistry of cultured hippocampal neurons revealed a somatodendritic and axonal localization and punctate labelling in direct apposition to VGluT1 and PSD-95 immunoreactivity (Fig.6D). Pre-embedding immuno-gold labelling demonstrates localization of FXYD6 at presynaptic, axonal, and dendritic plasma membranes in the hippocampus and striatum (Fig.6E,F and Fig. S3D). Antibody: FXYD6 (1:2,000; Delprat et al, 2007): A polyclonal FXYD6 antibody directed against a C-terminal glu- tathione S-transferase fusion peptide of mouse FXYD6 (62- CSFNQKPRAPGDEEAQVENLITTNAAEPQKAEN) was pro- duced by Pascal Béguin. No KO-control. |
| Evidence tracking, Biological System: | Intact tissue Cultured neurons |
| Evidence tracking, Protein Targeting: | Antibody (detection) |
| Evidence tracking, Experiment Assay: | Electron Microscopy Microscopy (generic) Western blot Mass-spectrometry Biochemical fractionation (generic) |
| Annotator(s): | Noa Lipstein (ORCID:0000-0002-0755-5899) Cordelia Imig (ORCID:0000-0001-7351-8706) Vincent O'connor (ORCID:0000-0003-3185-5709) Nils Brose (ORCID:0000-0003-0938-8534) |
| Lab: | Department of Molecular Neurobiology, Max Planck Institute of Experimental Medicine, 37075 Göttingen, Germany |
| Additional literature: | Description of the FXYD protein family. @ PMID:16403837 Description of the antibody used in this study. @ PMID:17209044 |
| SynGO annotation ID: | 731 |
| Dataset release (version): | 20231201 |
| View annotation as GO-CAM model: |